PIP5K3 monoclonal antibody (M01), clone 6C7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PIP5K3.
Immunogen
PIP5K3 (NP_689884, 342 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQIAEEGDDNLANSASPSKRTSVSSFQSTVDSDSAASISLNVELDNVNFHIKKPSKYPHVPPHPADQKGRR
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PIP5K3 expression in transfected 293T cell line by PIP5K3 monoclonal antibody (M01), clone 6C7.
Lane 1: PIP5K3 transfected lysate(50.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PIP5K3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PIP5K3 is approximately 0.3ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of PIP5K3 over-expressed 293 cell line, cotransfected with PIP5K3 Validated Chimera RNAi ( Cat # H00200576-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PIP5K3 monoclonal antibody (M01), clone 6C7 (Cat # H00200576-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to PIP5K3 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PIP5K3
Entrez GeneID
200576GeneBank Accession#
NM_152671Protein Accession#
NP_689884Gene Name
PIP5K3
Gene Alias
CFD, FAB1, KIAA0981, MGC40423, PIKFYVE, PIP5K
Gene Description
phosphatidylinositol-3-phosphate/phosphatidylinositol 5-kinase, type III
Gene Ontology
HyperlinkGene Summary
PIP5K3 belongs to a large family of lipid kinases that alter the phosphorylation status of intracellular phosphatidylinositol. Signaling by phosphorylated species of phosphatidylinositol regulates diverse cellular processes, including membrane trafficking and cytoskeletal reorganization (Shisheva et al., 1999 [PubMed 9858586]).[supplied by OMIM
Other Designations
1-phosphatidylinositol-4-phosphate 5-kinase|FYVE finger-containing phosphoinositide kinase|OTTHUMP00000163872|PtdIns(4)P-5-kinase|phosphatidylinositol-3-phosphate 5-kinase type III|phosphatidylinositol-4-phosphate 5-kinase, type III
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
New insights into the role of endosomal proteins for African swine fever virus infection.
Miguel Ángel Cuesta-Geijo, Isabel García-Dorival, Ana Del Puerto, Jesús Urquiza, Inmaculada Galindo, Lucía Barrado-Gil, Fátima Lasala, Ana Cayuela, Carlos Oscar S Sorzano, Carmen Gil, Rafael Delgado, Covadonga Alonso.
PLoS Pathogens 2022 Jan; 18(1):e1009784.
Application:WB-Tr, Human, HEK 293T (Bosc 23) cells.
-
Phosphoinositide phosphatase Sac3 regulates the cell surface expression of scavenger receptor A and formation of lipid droplets in macrophages.
Morioka S, Nigorikawa K, Hazeki K, Ohmura M, Sakamoto H, Matsumura T, Takasuga S, Hazeki O.
Experimental Cell Research 2017 May; 357(2):252.
Application:WB-Tr, Mouse, Raw 264.7 cells.
-
PIKfyve, a class III PI kinase, is the target of the small molecular IL-12/IL-23 inhibitor apilimod and a player in Toll-like receptor signaling.
Xinming Cai, Yongyao Xu, Atwood K Cheung, Ronald C Tomlinson, Abel Alcázar-Román, Leon Murphy, Andreas Billich, Bailin Zhang, Yan Feng, Martin Klumpp, Jean-Michel Rondeau, Aleem N Fazal, Christopher J Wilson, Vic Myer, Gerard Joberty, Tewis Bouwmeester, Mark A Labow, Peter M Finan, Jeffrey A Porter, Hidde L Ploegh, Daniel Baird, Pietro De Camilli, John A Tallarico, Qian Huang.
Chemistry & Biology 2013 Jul; 20(7):912.
Application:WB, Human, THP-1, U2OS cells.
-
Critical roles of type III phosphatidylinositol phosphate kinase in murine embryonic visceral endoderm and adult intestine.
Takasuga S, Horie Y, Sasaki J, Sun-Wada GH, Kawamura N, Iizuka R, Mizuno K, Eguchi S, Kofuji S, Kimura H, Yamazaki M, Horie C, Odanaga E, Sato Y, Chida S, Kontani K, Harada A, Katada T, Suzuki A, Wada Y, Ohnishi H, Sasaki T.
PNAS 2013 Jan; 110(5):1726.
Application:WB, Mouse, Mouse ES cells.
-
PIKfyve regulates CaV1.2 degradation and prevents excitotoxic cell death.
Tsuruta F, Green EM, Rousset M, Dolmetsch RE.
The Journal of Cell Biology 2009 Oct; 187(2):279.
Application:IP, WB-Ce, Rat, Rat neurons.
-
New insights into the role of endosomal proteins for African swine fever virus infection.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com