Product Browser

Last updated: 2023/5/29

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

SGMS2 (Human) Recombinant Protein (Q01) 

  • Catalog # : H00166929-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SGMS2 partial ORF ( NP_689834, 2 a.a. - 80 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • DIIETAKLEEHLENQPSDPTNTYARPAEPVEEENKNGNGKPKSLSSGLRKGTKKYPDYIQIAMPTESRNKFPLEWWKTG
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 34.43
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00166929-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • SGMS2
  • Gene Alias:
  • MGC26963,SMS2
  • Gene Description:
  • sphingomyelin synthase 2
  • Gene Summary:
  • Sphingomyelin, a major component of cell and Golgi membranes, is made by the transfer of phosphocholine from phosphatidylcholine onto ceramide, with diacylglycerol as a side product. The protein encoded by this gene is an enzyme that catalyzes this reaction primarily at the cell membrane. The synthesis is reversible, and this enzyme can catalyze the reaction in either direction. The encoded protein is required for cell growth. Three transcript variants encoding the same protein have been found for this gene. There is evidence for more variants, but the full-length nature of their transcripts has not been determined
  • Other Designations:
  • OTTHUMP00000162627,OTTHUMP00000162628,SM synthase,phosphatidylcholine:ceramide cholinephosphotransferase 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook