Product Browser

Last updated: 2023/5/29

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

RP1-127L4.6 MaxPab mouse polyclonal antibody (B02P) MaxPab

  • Catalog # : H00150297-B02P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human RP1-127L4.6 protein.
  • Immunogen:
  • RP1-127L4.6 (CAG30371.1, 1 a.a. ~ 256 a.a) full-length human protein.
  • Sequence:
  • MGSKLTCCLGPSGGLNCDCCRPDVGPCHECEIPETVAATAPASTTAKPAKLDLKAKKAQLMQYLSLPKTPKMLKMSKGLDARSKRWLKIIWRRHGIWPLENIGPTEDVQASAHGGVEENMTSDIEIPEAKHDHRPTEDVQVSAHGGVEENITSDIEISEAKHDHHLVEDLSESLSVCLEDFMTSDLSESLSVSLEDFMTSGLSESLSVSLEDLMTPEMAKERYEDYLCWVKMARSRLNEPISSQVLGLLRLPTFLY
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot analysis of RP1-127L4.6 expression in transfected 293T cell line (H00150297-T02) by RP1-127L4.6 MaxPab polyclonal antibody.

    Lane 1: RP1-127L4.6 transfected lysate(27.61 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Gene Information
  • Gene Name:
  • RP1-127L4.6
  • Gene Alias:
  • LOC150297,dJ90G24.6
  • Gene Description:
  • hypothetical protein LOC150297
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook