TRIM9 monoclonal antibody (M01), clone 1F12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of TRIM9 expression in transfected 293T cell line by TRIM9 monoclonal antibody (M01), clone 1F12.
Lane 1: TRIM9 transfected lysate(61.3 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TRIM9.
Immunogen
TRIM9 (NP_055978.4, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TRIM9 expression in transfected 293T cell line by TRIM9 monoclonal antibody (M01), clone 1F12.
Lane 1: TRIM9 transfected lysate(61.3 KDa).
Lane 2: Non-transfected lysate.
ELISA
-
Gene Info — TRIM9
Entrez GeneID
114088GeneBank Accession#
NM_015163.5Protein Accession#
NP_055978.4Gene Name
TRIM9
Gene Alias
KIAA0282, RNF91, SPRING
Gene Description
tripartite motif-containing 9
Omim ID
606555Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. Its function has not been identified. Alternate splicing of this gene generates two transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
homolog of rat RING finger Spring|tripartite motif protein 9
-
Interactome
-
Disease
-
Publication Reference
-
A pair of E3 ubiquitin ligases compete to regulate filopodial dynamics and axon guidance.
Nicholas P Boyer, Laura E McCormick, Shalini Menon, Fabio L Urbina, Stephanie L Gupton.
The Journal of Cell Biology 2020 Jan; 219(1):e201902088.
Application：IF, WB-Tr, Mouse, Mouse cortical lysates.
-
Negative regulation of NF-κB activity by brain-specific TRIpartite Motif protein 9.
Shi M, Cho H, Inn KS, Yang A, Zhao Z, Liang Q, Versteeg GA, Amini-Bavil-Olyaee S, Wong LY, Zlokovic BV, Park HS, Garcia-Sastre A, Jung JU.
Nature Communications 2014 Sep; 5:4820.
Application：IP, WB, Human, SK-N-AS neuroblastoma cells.
-
A novel Netrin-1-sensitive mechanism promotes local SNARE-mediated exocytosis during axon branching.
Winkle CC, McClain LM, Valtschanoff JG, Park CS, Maglione C, Gupton SL.
The Journal of Cell Biology 2014 Apr; 205(2):217.
Application：WB-Ti, Mouse, Brain, Embryonic cortex, Cortical neurons.
-
A pair of E3 ubiquitin ligases compete to regulate filopodial dynamics and axon guidance.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com