MCFD2 monoclonal antibody (M01), clone 3A5-G4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of MCFD2 expression in transfected 293T cell line by MCFD2 monoclonal antibody (M01), clone 3A5-G4.
Lane 1: MCFD2 transfected lysate(16.4 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MCFD2 on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MCFD2 is 0.1 ng/ml as a capture antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MCFD2 is 1 ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of MCFD2 over-expressed 293 cell line, cotransfected with MCFD2 Validated Chimera RNAi ( Cat # H00090411-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MCFD2 monoclonal antibody (M01), clone 3A5-G4 (Cat # H00090411-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (41.8 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant MCFD2.
Immunogen
MCFD2 (AAH40357, 1 a.a. ~ 146 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MTMRSLLRTPFLCGLLWAFCAPGARAEEPAASFSQPGSMGLDKNTVHDQEHIMEHLEGVINKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKSLQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (41.8 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MCFD2 expression in transfected 293T cell line by MCFD2 monoclonal antibody (M01), clone 3A5-G4.
Lane 1: MCFD2 transfected lysate(16.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MCFD2 on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MCFD2 is 0.1 ng/ml as a capture antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MCFD2 is 1 ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of MCFD2 over-expressed 293 cell line, cotransfected with MCFD2 Validated Chimera RNAi ( Cat # H00090411-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MCFD2 monoclonal antibody (M01), clone 3A5-G4 (Cat # H00090411-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — MCFD2
Entrez GeneID
90411GeneBank Accession#
BC040357Protein Accession#
AAH40357Gene Name
MCFD2
Gene Alias
DKFZp686G21263, F5F8D, LMAN1IP, SDNSF
Gene Description
multiple coagulation factor deficiency 2
Gene Ontology
HyperlinkOther Designations
multiple coagulation factor deficiency protein 2|neural stem cell derived neuronal survival protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com