NANOG monoclonal antibody (M04), clone 3A12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
NANOG monoclonal antibody (M04), clone 3A12. Western Blot analysis of NANOG expression in MCF-7.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NANOG is approximately 0.03ng/ml as a capture antibody.
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NANOG.
Immunogen
NANOG (NP_079141, 98 a.a. ~ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPM
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (56); Rat (59)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NANOG monoclonal antibody (M04), clone 3A12. Western Blot analysis of NANOG expression in MCF-7.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NANOG is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — NANOG
-
Interactome
-
Publication Reference
-
Phosphoproteomics of the developing heart identifies PERM1 - An outer mitochondrial membrane protein.
Sriram Aravamudhan, Clara Türk, Theresa Bock, Lena Keufgens, Hendrik Nolte, Franziska Lang, Ramesh Kumar Krishnan, Tim König, Philipp Hammerschmidt, Natalie Schindler, Susanne Brodesser, Dieu Hien Rozsivalova, Elena Rugarli, Aleksandra Trifunovic, Jens Brüning, Thomas Langer, Thomas Braun, Marcus Krüger.
Journal of Molecular and Cellular Cardiology 2021 May; 154:41.
Application：WB-Tr, Human, HEK 293T cells.
-
Phosphoproteomics of the developing heart identifies PERM1 - An outer mitochondrial membrane protein.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com