NOL6 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human NOL6 full-length ORF ( AAH08298, 1 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MVIVTPQDRKNSVWTQDGPSAQILQQLVVLAAEALPMLEKQLMDPRGPGDIRTVFRPPLDIYDVLIRLSPRHIPRHRQAVDSPAASFCRGLLSQPGPSSLMPVLGYDPPQLYLTQLREAFGDLALFFYDQHGGEVIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLGEGLVQTVEARSERWTV
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
47.74
Interspecies Antigen Sequence
Mouse (84); Rat (86)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — NOL6
Entrez GeneID
65083GeneBank Accession#
BC008298Protein Accession#
AAH08298Gene Name
NOL6
Gene Alias
FLJ21959, MGC14896, MGC14921, MGC20838, NRAP, UTP22, bA311H10.1
Gene Description
nucleolar protein family 6 (RNA-associated)
Omim ID
611532Gene Ontology
HyperlinkGene Summary
The nucleolus is a dense subnuclear membraneless organelle that assembles around clusters of rRNA genes and functions in ribosome biogenesis. This gene encodes a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts. Alternative splicing has been observed at this locus and two splice variants encoding distinct isoforms have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000000449|OTTHUMP00000000450|OTTHUMP00000000451|OTTHUMP00000000452|nucleolar protein family 6
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com