NOL6 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of NOL6 expression in transfected 293T cell line (H00065083-T01) by NOL6 MaxPab polyclonal antibody.
Lane 1: NOL6 transfected lysate(22.11 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to NOL6 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human NOL6 protein.
Immunogen
NOL6 (AAH08298, 1 a.a. ~ 200 a.a) full-length human protein.
Sequence
MVIVTPQDRKNSVWTQDGPSAQILQQLVVLAAEALPMLEKQLMDPRGPGDIRTVFRPPLDIYDVLIRLSPRHIPRHRQAVDSPAASFCRGLLSQPGPSSLMPVLGYDPPQLYLTQLREAFGDLALFFYDQHGGEVIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLGEGLVQTVEARSERWTV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84); Rat (86)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of NOL6 expression in transfected 293T cell line (H00065083-T01) by NOL6 MaxPab polyclonal antibody.
Lane 1: NOL6 transfected lysate(22.11 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to NOL6 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — NOL6
Entrez GeneID
65083GeneBank Accession#
BC008298Protein Accession#
AAH08298Gene Name
NOL6
Gene Alias
FLJ21959, MGC14896, MGC14921, MGC20838, NRAP, UTP22, bA311H10.1
Gene Description
nucleolar protein family 6 (RNA-associated)
Omim ID
611532Gene Ontology
HyperlinkGene Summary
The nucleolus is a dense subnuclear membraneless organelle that assembles around clusters of rRNA genes and functions in ribosome biogenesis. This gene encodes a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts. Alternative splicing has been observed at this locus and two splice variants encoding distinct isoforms have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000000449|OTTHUMP00000000450|OTTHUMP00000000451|OTTHUMP00000000452|nucleolar protein family 6
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com