ATG16L1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ATG16L1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ATG16L1 expression in HeLa.
Western Blot (Transfected lysate)
Western Blot analysis of ATG16L1 expression in transfected 293T cell line (H00055054-T02) by ATG16L1 MaxPab polyclonal antibody.
Lane 1: ATG16L1 transfected lysate(58.30 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human ATG16L1 protein.
Immunogen
ATG16L1 (NP_110430.4, 1 a.a. ~ 523 a.a) full-length human protein.
Sequence
MAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDTHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQY
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ATG16L1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ATG16L1 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of ATG16L1 expression in transfected 293T cell line (H00055054-T02) by ATG16L1 MaxPab polyclonal antibody.
Lane 1: ATG16L1 transfected lysate(58.30 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ATG16L1
Entrez GeneID
55054GeneBank Accession#
BC117337Protein Accession#
NP_110430.4Gene Name
ATG16L1
Gene Alias
APG16L, ATG16L, FLJ00045, FLJ10035, FLJ10828, FLJ22677, IBD10, WDR30
Gene Description
ATG16 autophagy related 16-like 1 (S. cerevisiae)
Gene Ontology
HyperlinkGene Summary
Autophagy is the major intracellular degradation system delivering cytoplasmic components to lysosomes, and it accounts for degradation of most long-lived proteins and some organelles. Cytoplasmic constituents, including organelles, are sequestered into double-membraned autophagosomes, which subsequently fuse with lysosomes. ATG16L1 is a component of a large protein complex essential for autophagy (Mizushima et al., 2003 [PubMed 12665549]).[supplied by OMIM
Other Designations
APG16 autophagy 16-like|APG16L beta|ATG16 autophagy related 16-like protein 1|WD repeat domain 30
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com