DNAJC10 monoclonal antibody (M01), clone 3C4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
DNAJC10 monoclonal antibody (M01), clone 3C4. Western Blot analysis of DNAJC10 expression in NIH/3T3 ( Cat # L018V1 ).
Western Blot (Cell lysate)
DNAJC10 monoclonal antibody (M01), clone 3C4. Western Blot analysis of DNAJC10 expression in HeLa ( Cat # L013V1 ).
Western Blot (Cell lysate)
DNAJC10 monoclonal antibody (M01), clone 3C4. Western Blot analysis of DNAJC10 expression in PC-12 ( Cat # L012V1 ).
Western Blot (Cell lysate)
DNAJC10 monoclonal antibody (M01), clone 3C4. Western Blot analysis of DNAJC10 expression in Raw 264.7 ( Cat # L024V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to DNAJC10 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DNAJC10 is approximately 10ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to DNAJC10 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.4 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DNAJC10.
Immunogen
DNAJC10 (NP_061854, 688 a.a. ~ 793 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KNHWVIDFYAPWCGPCQNFAPEFELLARMIKGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFYFYERAKRNFQEEQINTRDAKAIAALISEKLETLRNQGKRNKDEL
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (90); Rat (90)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.4 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
DNAJC10 monoclonal antibody (M01), clone 3C4. Western Blot analysis of DNAJC10 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
DNAJC10 monoclonal antibody (M01), clone 3C4. Western Blot analysis of DNAJC10 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
DNAJC10 monoclonal antibody (M01), clone 3C4. Western Blot analysis of DNAJC10 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
DNAJC10 monoclonal antibody (M01), clone 3C4. Western Blot analysis of DNAJC10 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to DNAJC10 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DNAJC10 is approximately 10ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to DNAJC10 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — DNAJC10
Entrez GeneID
54431GeneBank Accession#
NM_018981Protein Accession#
NP_061854Gene Name
DNAJC10
Gene Alias
DKFZp434J1813, ERdj5, JPDI, MGC104194
Gene Description
DnaJ (Hsp40) homolog, subfamily C, member 10
Omim ID
607987Gene Ontology
HyperlinkGene Summary
subfamily C
Other Designations
ER-resident protein ERdj5|J-domain-containing protein disulfide isomerase-like protein|macrothioredoxin
-
Interactome
-
Publication Reference
-
The oxidative folding of nascent polypeptides provides electrons for reductive reactions in the ER.
Kaiku Uegaki, Yuji Tokunaga, Michio Inoue, Seiji Takashima, Kenji Inaba, Koh Takeuchi, Ryo Ushioda, Kazuhiro Nagata.
Cell Reports 2023 Jul; 42(7):112742.
Application：WB, Human, HEK293T cells.
-
Mapping SP-C co-chaperone binding sites reveals molecular consequences of disease-causing mutations on protein maturation.
Kristine F R Pobre-Piza, Melissa J Mann, Ashley R Flory, Linda M Hendershot.
Nature Communications 2022 Apr; 13(1):1821.
Application：WB, Human, HEK 293T cells.
-
The oxidative folding of nascent polypeptides provides electrons for reductive reactions in the ER.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com