ABHD5 polyclonal antibody (A02)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ABHD5 polyclonal antibody (A02), Lot # 060103JC01. Western Blot analysis of ABHD5 expression in NIH/3T3.
Western Blot (Cell lysate)
ABHD5 polyclonal antibody (A02), Lot # 060103JC01. Western Blot analysis of ABHD5 expression in Raw 264.7.
Western Blot (Cell lysate)
ABHD5 polyclonal antibody (A02), Lot # 060103JC01. Western Blot analysis of ABHD5 expression in PC-12.
Western Blot (Cell lysate)
ABHD5 polyclonal antibody (A02), Lot # 060103JC01 Western Blot analysis of ABHD5 expression in HepG2 ( Cat # L019V1 ).
Western Blot detection against Immunogen (37.44 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant ABHD5.
Immunogen
ABHD5 (NP_057090, 240 a.a. ~ 342 a.a) partial recombinant protein with GST tag.
Sequence
FEDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQRIGKMHPDIPVSVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQKVK
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.44 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ABHD5 polyclonal antibody (A02), Lot # 060103JC01. Western Blot analysis of ABHD5 expression in NIH/3T3.Western Blot (Cell lysate)
ABHD5 polyclonal antibody (A02), Lot # 060103JC01. Western Blot analysis of ABHD5 expression in Raw 264.7.Western Blot (Cell lysate)
ABHD5 polyclonal antibody (A02), Lot # 060103JC01. Western Blot analysis of ABHD5 expression in PC-12.Western Blot (Cell lysate)
ABHD5 polyclonal antibody (A02), Lot # 060103JC01 Western Blot analysis of ABHD5 expression in HepG2 ( Cat # L019V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — ABHD5
Entrez GeneID
51099GeneBank Accession#
NM_016006Protein Accession#
NP_057090Gene Name
ABHD5
Gene Alias
CDS, CGI58, IECN2, MGC8731, NCIE2
Gene Description
abhydrolase domain containing 5
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in this gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation. [provided by RefSeq
Other Designations
-
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com