ARFIP2 monoclonal antibody (M01), clone 2B5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ARFIP2.
Immunogen
ARFIP2 (AAH00392, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGDGLIPTGSGRHPSHSTTPSGPGDEVARGIAGEKFDIVKKWGINTYKCTKQL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ARFIP2 monoclonal antibody (M01), clone 2B5 Western Blot analysis of ARFIP2 expression in IMR-32 ( Cat # L008V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ARFIP2 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — ARFIP2
-
Interactome
-
Publication Reference
-
Recruitment of arfaptins to the trans-Golgi network by PI(4)P and their involvement in cargo export.
Cruz-Garcia D, Ortega-Bellido M, Scarpa M, Villeneuve J, Jovic M, Porzner M, Balla T, Seufferlein T, Malhotra V.
The EMBO Journal 2013 Jun; 32(12):1717.
Application:IF, WB-Tr, Human, HeLa, BON cells.
-
Arfaptins Are Localized to the trans-Golgi by Interaction with Arl1, but Not Arfs.
Man Z, Kondo Y, Koga H, Umino H, Nakayama K, Shin HW.
The Journal of Biological Chemistry 2011 Apr; 286(13):11569.
Application:IF, WB-Tr, Human, HeLa cells.
-
Recruitment of arfaptins to the trans-Golgi network by PI(4)P and their involvement in cargo export.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com