RBM9 monoclonal antibody (M01), clone 4G3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RBM9.
Immunogen
RBM9 (AAH13115, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQS
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RBM9 monoclonal antibody (M01), clone 4G3 Western Blot analysis of RBM9 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Transfected lysate)
Western Blot analysis of RBM9 expression in transfected 293T cell line by RBM9 monoclonal antibody (M01), clone 4G3.
Lane 1: RBM9 transfected lysate(40.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RBM9 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RBM9 is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of RBM9 over-expressed 293 cell line, cotransfected with RBM9 Validated Chimera RNAi ( Cat # H00023543-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RBM9 monoclonal antibody (M01), clone 4G3 (Cat # H00023543-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to RBM9 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — RBM9
Entrez GeneID
23543GeneBank Accession#
BC013115Protein Accession#
AAH13115Gene Name
RBM9
Gene Alias
FOX2, Fox-2, HNRBP2, HRNBP2, RTA, dJ106I20.3, fxh
Gene Description
RNA binding motif protein 9
Gene Ontology
HyperlinkGene Summary
This gene is one of several human genes similar to the C. elegans gene Fox-1. This gene encodes an RNA binding protein that is thought to be a key regulator of alternative exon splicing in the nervous system and other cell types. The protein binds to a conserved UGCAUG element found downstream of many alternatively spliced exons and promotes inclusion of the alternative exon in mature transcripts. The protein also interacts with the estrogen receptor 1 transcription factor and regulates estrogen receptor 1 transcriptional activity. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000028771|fox-1 homologue|hexaribonucleotide binding protein 2|repressor of tamoxifen transcriptional activity
-
Interactome
-
Publication Reference
-
FOX-2 dependent splicing of ataxin-2 transcript is affected by ataxin-1 overexpression.
Welzel F, Kaehler C, Isau M, Hallen L, Lehrach H, Krobitsch S.
PLoS One 2012 May; 7(5):e37985.
Application:IF, IP, Human, HEK 293T, HeLa cells.
-
FOX-2 dependent splicing of ataxin-2 transcript is affected by ataxin-1 overexpression.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com