TRIM16 monoclonal antibody (M01), clone 5F4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TRIM16.
Immunogen
TRIM16 (NP_006461, 165 a.a. ~ 273 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LDAARRDKEAELQCTQLDLERKLKLNENAISRLQANQKSVLVSVSEVKAVAEMQFGELLAAVRKAQANVMLFLEEKEQAALSQANGIKAHLEYRSAEMEKSKQELERMA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (77); Rat (76)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TRIM16 expression in transfected 293T cell line by TRIM16 monoclonal antibody (M01), clone 5F4.
Lane 1: TRIM16 transfected lysate(64 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of TRIM16 transfected lysate using anti-TRIM16 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TRIM16 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TRIM16 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of TRIM16 over-expressed 293 cell line, cotransfected with TRIM16 Validated Chimera RNAi ( Cat # H00010626-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TRIM16 monoclonal antibody (M01), clone 5F4 (Cat # H00010626-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — TRIM16
Entrez GeneID
10626GeneBank Accession#
NM_006470Protein Accession#
NP_006461Gene Name
TRIM16
Gene Alias
EBBP
Gene Description
tripartite motif-containing 16
Omim ID
609505Gene Ontology
HyperlinkGene Summary
This gene was identified as an estrogen and anti-estrogen regulated gene in epithelial cells stably expressing estrogen receptor. The protein encoded by this gene contains two B box domains and a coiled-coiled region that are characteristic of the B box zinc finger protein family. The proteins of this family have been reported to be involved in a variety of biological processes including cell growth, differentiation and pathogenesis. Expression of this gene was detected in most tissues. Its function, however, has not yet been determined. [provided by RefSeq
Other Designations
estrogen-responsive B box protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com