Product Browser

Last updated: 2023/5/29

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

TANK MaxPab mouse polyclonal antibody (B02P) MaxPab

  • Catalog # : H00010010-B02P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human TANK protein.
  • Immunogen:
  • TANK (NP_597841.1, 1 a.a. ~ 119 a.a) full-length human protein.
  • Sequence:
  • MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVDIASAESSI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Interspecies Antigen Sequence:
  • Mouse (79); Rat (78)
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TANK expression in transfected 293T cell line (H00010010-T02) by TANK MaxPab polyclonal antibody.

    Lane 1: TANK transfected lysate(13.09 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • TANK
  • Gene Alias:
  • I-TRAF,TRAF2
  • Gene Description:
  • TRAF family member-associated NFKB activator
  • Gene Summary:
  • The TRAF (tumor necrosis factor receptor-associated factor) family of proteins associate with and transduce signals from members of the tumor necrosis factor receptor superfamily. The protein encoded by this gene is found in the cytoplasm and can bind to TRAF1, TRAF2, or TRAF3, thereby inhibiting TRAF function by sequestering the TRAFs in a latent state in the cytoplasm. For example, the protein encoded by this gene can block TRAF2 binding to LMP1, the Epstein-Barr virus transforming protein, and inhibit LMP1-mediated NF-kappa-B activation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • TRAF family member-associated NF-KAPPA-B activator,TRAF interacting protein TANK
  • RSS
  • YouTube
  • Linkedin
  • Facebook