ABCG1 monoclonal antibody (M03), clone 2H8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ABCG1 is 1 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to ABCG1 on HeLa cell . [antibody concentration 20 ug/ml]
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ABCG1.
Immunogen
ABCG1 (AAH29158, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLPRRAAVNIEFRDLSYSVPEGPWWRKKGYKTLLKGISGKFNSGELVAIMGPSGAGKSTLMNI
Host
Mouse
Reactivity
Human
Isotype
IgG1
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ABCG1 is 1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to ABCG1 on HeLa cell . [antibody concentration 20 ug/ml] -
Gene Info — ABCG1
Entrez GeneID
9619GeneBank Accession#
BC029158Protein Accession#
AAH29158Gene Name
ABCG1
Gene Alias
ABC8, MGC34313, WHITE1
Gene Description
ATP-binding cassette, sub-family G (WHITE), member 1
Omim ID
603076Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. It is involved in macrophage cholesterol and phospholipids transport, and may regulate cellular lipid homeostasis in other cell types. Six alternative splice variants have been identified. [provided by RefSeq
Other Designations
ABC transporter 8|ATP-binding cassette sub-family G member 1|ATP-binding cassette transporter 8|ATP-binding cassette transporter member 1 of subfamily G|OTTHUMP00000109322|homolog of Drosophila white|white protein homolog (ATP-binding cassette transporter
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
7-Ketocholesterol and cholestane-triol increase expression of SMO and LXRα signaling pathways in a human breast cancer cell line.
Debora Levy, Thatiana Correa de Melo, Beatriz A Oliveira, Jessica L Paz, Fabio A de Freitas, Cadiele O Reichert, Alessandro Rodrigues, Sergio P Bydlowski.
Biochemistry and Biophysics Reports 2018 Dec; 19:100604.
Application：IF, Human, MDA-MB-231 cells.
-
7-Ketocholesterol and cholestane-triol increase expression of SMO and LXRα signaling pathways in a human breast cancer cell line.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com