Product Browser

Last updated: 2023/3/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

EIF4E2 MaxPab mouse polyclonal antibody (B01P) MaxPab

  • Catalog # : H00009470-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human EIF4E2 protein.
  • Immunogen:
  • EIF4E2 (AAH21690.1, 1 a.a. ~ 245 a.a) full-length human protein.
  • Sequence:
  • MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Interspecies Antigen Sequence:
  • Mouse (98)
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of EIF4E2 expression in transfected 293T cell line (H00009470-T01) by EIF4E2 MaxPab polyclonal antibody.

    Lane 1: EIF4E2 transfected lysate(26.95 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9470
  • Gene Name:
  • EIF4E2
  • Gene Alias:
  • 4E-LP,4EHP,EIF4EL3,IF4e
  • Gene Description:
  • eukaryotic translation initiation factor 4E family member 2
  • Other Designations:
  • eIF4E-like cap-binding protein,eukaryotic translation initiation factor 4E member 2,eukaryotic translation initiation factor 4E-like 3
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook