CYP7B1 monoclonal antibody (M06), clone 2B11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CYP7B1 expression in transfected 293T cell line by CYP7B1 monoclonal antibody (M06), clone 2B11.
Lane 1: CYP7B1 transfected lysate(58.256 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CYP7B1 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CYP7B1 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (34.98 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CYP7B1.
Immunogen
CYP7B1 (NP_004811, 203 a.a. ~ 286 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CDNNKFISELRDDFLKFDDKFAYLVSNIPIELLGNVKSIREKIIKCFSSEKLAKMQGWSEVFQSRQDVLEKYYVHEDLEIGAHH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (67); Rat (66)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.98 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CYP7B1 expression in transfected 293T cell line by CYP7B1 monoclonal antibody (M06), clone 2B11.
Lane 1: CYP7B1 transfected lysate(58.256 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CYP7B1 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CYP7B1 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — CYP7B1
Entrez GeneID
9420GeneBank Accession#
NM_004820Protein Accession#
NP_004811Gene Name
CYP7B1
Gene Alias
CBAS3, CP7B, SPG5A
Gene Description
cytochrome P450, family 7, subfamily B, polypeptide 1
Omim ID
603711Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum membrane protein catalyzes the first reaction in the cholesterol catabolic pathway of extrahepatic tissues, which converts cholesterol to bile acids. This enzyme likely plays a minor role in total bile acid synthesis, but may also be involved in the development of atherosclerosis, neurosteroid metabolism and sex hormone synthesis. [provided by RefSeq
Other Designations
cytochrome P450, subfamily VIIB (oxysterol 7 alpha-hydroxylase), polypeptide 1|oxysterol 7alpha-hydroxylase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com