SERPINB7 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SERPINB7 partial ORF ( NP_003775.1, 227 a.a. - 327 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
LELRYNGGINMYVLLPENDLSEIENKLTFQNLMEWTNPRRMTSKYVEVFFPQFKIEKNYEMKQYLRALGLKDIFDESKADLSGIASGGRLYISRMMHKSYI
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.85
Interspecies Antigen Sequence
Mouse (73); Rat (71)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SERPINB7
Entrez GeneID
8710GeneBank Accession#
NM_003784Protein Accession#
NP_003775.1Gene Name
SERPINB7
Gene Alias
DKFZp686D06190, MEGSIN, MGC120014, MGC120015
Gene Description
serpin peptidase inhibitor, clade B (ovalbumin), member 7
Omim ID
603357Gene Ontology
HyperlinkGene Summary
clade B (ovalbumin)
Other Designations
mesangium predominant gene, megsin|serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 7
-
Interactome
-
Disease
-
Publication Reference
-
SerpinB7 deficiency contributes to development of psoriasis via calcium-mediated keratinocyte differentiation dysfunction.
Huaping Zheng, Linna Gu, Fulei Zhao, Chen Zhang, Zhen Wang, Hong Zhou, Zhonglan Hu, Xiaoqiong Wei, Xiao Liu, Feng Luo, Fanlian Zeng, Qixiang Zhao, Yan Hao, Yawen Hu, Xiaoyan Wang, Jing Hu, Jiadong Yu, Wenling Wu, Yifan Zhou, Pei Zhou, Chengcheng Yue, Nongyu Huang, Kaijun Cui, Wei Li, Jiong Li.
Cell Death & Disease 2022 Jul; 13(7):635.
Application:Differentiation, Human, HaCaT cell.
-
SerpinB7 deficiency contributes to development of psoriasis via calcium-mediated keratinocyte differentiation dysfunction.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com