CXCR4 monoclonal antibody (M04), clone 2G9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
CXCR4 monoclonal antibody (M04), clone 2G9. Western Blot analysis of CXCR4 expression in human intestinal wall.
Western Blot (Tissue lysate)
CXCR4 monoclonal antibody (M04), clone 2G9. Western Blot analysis of CXCR4 expression in human colon.
Western Blot (Cell lysate)
CXCR4 monoclonal antibody (M04), clone 2G9. Western Blot analysis of CXCR4 expression in RIN-m5F.
Western Blot (Transfected lysate)
Western Blot analysis of CXCR4 expression in transfected 293T cell line by CXCR4 monoclonal antibody (M04), clone 2G9.
Lane 1: CXCR4 transfected lysate (Predicted MW: 39.7 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CXCR4 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (30.8 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CXCR4.
Immunogen
CXCR4 (AAH20968, 1 a.a. ~ 46 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (30.8 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CXCR4 monoclonal antibody (M04), clone 2G9. Western Blot analysis of CXCR4 expression in human intestinal wall.Western Blot (Tissue lysate)
CXCR4 monoclonal antibody (M04), clone 2G9. Western Blot analysis of CXCR4 expression in human colon.Western Blot (Cell lysate)
CXCR4 monoclonal antibody (M04), clone 2G9. Western Blot analysis of CXCR4 expression in RIN-m5F.Western Blot (Transfected lysate)
Western Blot analysis of CXCR4 expression in transfected 293T cell line by CXCR4 monoclonal antibody (M04), clone 2G9.
Lane 1: CXCR4 transfected lysate (Predicted MW: 39.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CXCR4 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — CXCR4
Entrez GeneID
7852GeneBank Accession#
BC020968Protein Accession#
AAH20968Gene Name
CXCR4
Gene Alias
CD184, D2S201E, FB22, HM89, HSY3RR, LAP3, LCR1, LESTR, NPY3R, NPYR, NPYRL, NPYY3R, WHIM
Gene Description
chemokine (C-X-C motif) receptor 4
Gene Ontology
HyperlinkGene Summary
This gene encodes a CXC chemokine receptor specific for stromal cell-derived factor-1. The protein has 7 transmembrane regions and is located on the cell surface. It acts with the CD4 protein to support HIV entry into cells and is also highly expressed in breast cancer cells. Mutations in this gene have been associated with WHIM (warts, hypogammaglobulinemia, infections, and myelokathexis) syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
Other Designations
C-X-C chemokine receptor type 4|CD184 antigen|chemokine (C-X-C motif), receptor 4 (fusin)|chemokine receptor 4|fusin|leukocyte-derived seven-transmembrane-domain receptor|lipopolysaccharide-associated protein 3|neuropeptide Y receptor Y3|seven transmembra
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
New Insights into Mechanisms and Functions of Chemokine (C-X-C Motif) Receptor 4 Heteromerization in Vascular Smooth Muscle.
Evans AE, Tripathi A, LaPorte HM, Brueggemann LI, Singh AK, Albee LJ, Byron KL, Tarasova NI, Volkman BF, Cho TY, Gaponenko V, Majetschak M.
International Journal of Molecular Sciences 2016 Jun; 17(5):E971.
Application：Flow Cyt, PLA, Human, Mouse, Aortic vascular smooth muscle cells.
-
Heteromerization of chemokine (C-X-C motif) receptor 4 with α1A/B-adrenergic receptors controls α1-adrenergic receptor function.
Tripathi A, Vana PG, Chavan TS, Brueggemann LI, Byron KL, Tarasova NI, Volkman BF, Gaponenko V, Majetschak M.
PNAS 2015 Mar; 112(13):E1659.
Application：PLA, Human, Rat, A7r5 cells, Human, Rat vascular smooth muscle cells.
-
New Insights into Mechanisms and Functions of Chemokine (C-X-C Motif) Receptor 4 Heteromerization in Vascular Smooth Muscle.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com