Product Browser

Last updated: 2023/3/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

BSND DNAxPab DNAxPabDNAxPab

  • Catalog # : H00007809-W01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human BSND DNA using DNAx™ Immune technology.
  • Immunogen:
  • BSND (NP_476517.1, 1 a.a. ~ 320 a.a) full-length human DNA
  • Sequence:
  • MADEKTFRIGFIVLGLFLLALGTFLMSHDRPQVYGTFYAMGSVMVIGGIIWSMCQCYPKITFVPADSDFQGILSPKAMGLLENGLAAEMKSPSPQPPYVRLWEEAAYDQSLPDFSHIQMKVMSYSEDHRSLLAPEMGQPKLGTSDGGEGGPGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDDLDMDSSEGSSPNASPHDREEACSPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGAGDLLPDKELGFEPDTQG
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Purification:
  • Protein A
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of BSND expression in transfected 293T cell line by BSND DNAxPab polyclonal antibody.

    Lane 1: BSND transfected lysate(56.32 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunofluorescence (Transfected cell)
  • Flow Cytometry (Transfected cell)
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Immunofluorescence (Transfected cell)
  • Flow Cytometry (Transfected cell)
  • Gene Information
  • Entrez GeneID:
  • 7809
  • Gene Name:
  • BSND
  • Gene Alias:
  • BART,MGC119283,MGC119284,MGC119285
  • Gene Description:
  • Bartter syndrome, infantile, with sensorineural deafness (Barttin)
  • Gene Summary:
  • This gene encodes an essential beta subunit for CLC chloride channels. These heteromeric channels localize to basolateral membranes of renal tubules and of potassium-secreting epithelia of the inner ear. Mutations in this gene have been associated with Bartter syndrome with sensorineural deafness. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000009804,barttin
  • RSS
  • YouTube
  • Linkedin
  • Facebook