SF1 monoclonal antibody (M01), clone 2E12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SF1.
Immunogen
SF1 (NP_004621, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERH
Host
Mouse
Reactivity
Human, Mouse
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SF1 monoclonal antibody (M01), clone 2E12. Western Blot analysis of SF1 expression in HeLa.Western Blot (Cell lysate)
SF1 monoclonal antibody (M01), clone 2E12. Western Blot analysis of SF1 expression in NIH/3T3.Western Blot (Transfected lysate)
Western Blot analysis of SF1 expression in transfected 293T cell line by SF1 monoclonal antibody (M01), clone 2E12.
Lane 1: SF1 transfected lysate (Predicted MW: 59.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SF1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of SF1 transfected lysate using anti-SF1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SF1 monoclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SF1 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to SF1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — SF1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com