UBTF monoclonal antibody (M01), clone 6B6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant UBTF.
Immunogen
UBTF (NP_055048, 551 a.a. ~ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQKQYKVHLDLWVKSLSPQDRAAYKEYIS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
UBTF monoclonal antibody (M01), clone 6B6 Western Blot analysis of UBTF expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to UBTF on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged UBTF is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to UBTF on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — UBTF
Entrez GeneID
7343GeneBank Accession#
NM_014233Protein Accession#
NP_055048Gene Name
UBTF
Gene Alias
NOR-90, UBF
Gene Description
upstream binding transcription factor, RNA polymerase I
Omim ID
600673Gene Ontology
HyperlinkGene Summary
Upstream binding factor (UBF) is a transcription factor required for expression of the 18S, 5.8S, and 28S ribosomal RNAs, along with SL1 (a complex of TBP (MIM 600075) and multiple TBP-associated factors or 'TAFs'). Two UBF polypeptides, of 94 and 97 kD, exist in the human (Bell et al., 1988 [PubMed 3413483]). UBF is a nucleolar phosphoprotein with both DNA binding and transactivation domains. Sequence-specific DNA binding to the core and upstream control elements of the human rRNA promoter is mediated through several HMG boxes (Jantzen et al., 1990 [PubMed 2330041]).[supplied by OMIM
Other Designations
-
-
Interactome
-
Publication Reference
-
Molecular conflicts disrupting centromere maintenance contribute to Xenopus hybrid inviability.
Maiko Kitaoka, Owen K Smith, Aaron F Straight, Rebecca Heald.
Current Biology : CB 2022 Sep; 32(18):3939.
Application:IF, Xenopus, Chromosome.
-
Nucleolar Stress Functions Upstream to Stimulate Expression of Autophagy Regulators.
David P Dannheisig, Anna Schimansky, Cornelia Donow, Astrid S Pfister.
Cancers 2021 Dec; 13(24):6220.
Application:WB-Tr, Human, Hela cells.
-
Superresolution microscopy reveals linkages between ribosomal DNA on heterologous chromosomes.
Potapova TA, Unruh JR, Yu Z, Rancati G, Li H, Stampfer MR, Gerton JL.
The Journal of Cell Biology 2019 Aug; 218(8):2492.
Application:IF, WB-Tr, Human, Human hTERT CHON-002 cell line, RPE1 cells.
-
The maternal nucleolus plays a key role in centromere satellite maintenance during the oocyte to embryo transition.
Fulka H, Langerova A.
Development 2014 Apr; 141(8):1694.
Application:IF, WB-Ti, Mouse, Oocytes, Embryos.
-
Role of Ooplasm in Nuclear and Nucleolar Remodeling of Intergeneric Somatic Cell Nuclear Transfer Embryos during the First Cell Cycle.
Ostrup O, Strejcek F, Petrovicova I, Lucas-Hahn A, Morovic M, Lemme E, Petersen B, Laurincikova N, Niemann H, Laurincik J, Hyttel P.
Cell Reprogram 2011 Apr; 13:145.
Application:IF, Pig, Bovine, Embryos.
-
Nuclear and Nucleolar Reprogramming during the First Cell Cycle in Bovine Nuclear Transfer Embryos.
Ostrup O, Petrovicova I, Strejcek F, Morovic M, Lucas-Hahn A, Lemme E, Petersen B, Niemann H, Laurincik J, Maddox-Hyttel P.
Cloning and Stem Cells 2009 Sep; 11(3):367.
Application:IF, Bovine, Bovine nuclear transfer embryos.
-
Nucleologenesis and embryonic genome activation are defective in interspecies cloned embryos between bovine ooplasm and rhesus monkey somatic cells.
Song BS, Lee SH, Kim SU, Kim JS, Park JS, Kim CH, Chang KT, Han YM, Lee KK, Lee DS, Koo DB.
BMC Developmental Biology 2009 Jul; 9:44.
Application:IF, Bovine, Monkey, Monkey-bovine MB-iSCNT embryos.
-
Molecular conflicts disrupting centromere maintenance contribute to Xenopus hybrid inviability.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com