Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

TYROBP DNAxPab DNAxPabDNAxPab

  • Catalog # : H00007305-W01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human TYROBP DNA using DNAx™ Immune technology.
  • Immunogen:
  • TYROBP (NP_003323.1, 22 a.a. ~ 113 a.a) full-length human DNA
  • Sequence:
  • LRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Purification:
  • Protein A
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TYROBP expression in transfected 293T cell line by TYROBP DNAxPab polyclonal antibody.

    Lane 1: TYROBP transfected lysate(31.24 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunofluorescence (Transfected cell)
  • Flow Cytometry (Transfected cell)
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Immunofluorescence (Transfected cell)
  • Flow Cytometry (Transfected cell)
  • Gene Information
  • Entrez GeneID:
  • 7305
  • Gene Name:
  • TYROBP
  • Gene Alias:
  • DAP12,KARAP,PLOSL
  • Gene Description:
  • TYRO protein tyrosine kinase binding protein
  • Gene Summary:
  • This gene encodes a transmembrane signaling polypeptide which contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain. The encoded protein may associate with the killer-cell inhibitory receptor (KIR) family of membrane glycoproteins and may act as an activating signal transduction element. This protein may bind zeta-chain (TCR) associated protein kinase 70kDa (ZAP-70) and spleen tyrosine kinase (SYK) and play a role in signal transduction, bone modeling, brain myelination, and inflammation. Mutations within this gene have been associated with polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL), also known as Nasu-Hakola disease. Its putative receptor, triggering receptor expressed on myeloid cells 2 (TREM2), also causes PLOSL. Two alternative transcript variants encoding distinct isoforms have been identified for this gene. Other alternative splice variants have been described, but their full-length nature has not been deterimined. [provided by RefSeq
  • Other Designations:
  • DNAX-activation protein 12,killer activating receptor associated protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook