TSG101 monoclonal antibody (M01), clone 5B7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TSG101.
Immunogen
TSG101 (NP_006283, 201 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQE
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.54 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TSG101 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TSG101 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of TSG101 over-expressed 293 cell line, cotransfected with TSG101 Validated Chimera RNAi ( Cat # H00007251-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TSG101 monoclonal antibody (M01), clone 5B7 (Cat # H00007251-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to TSG101 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — TSG101
Entrez GeneID
7251GeneBank Accession#
NM_006292Protein Accession#
NP_006283Gene Name
TSG101
Gene Alias
TSG10, VPS23
Gene Description
tumor susceptibility gene 101
Omim ID
601387Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes. The gene product contains a coiled-coil domain that interacts with stathmin, a cytosolic phosphoprotein implicated in tumorigenesis. The protein may play a role in cell growth and differentiation and act as a negative growth regulator. In vitro steady-state expression of this tumor susceptibility gene appears to be important for maintenance of genomic stability and cell cycle regulation. Mutations and alternative splicing in this gene occur in high frequency in breast cancer and suggest that defects occur during breast cancer tumorigenesis and/or progression. [provided by RefSeq
Other Designations
tumor susceptibility protein
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Extracellular vesicles from biological fluids as potential markers in castration resistant prostate cancer.
Wendy W Y Choi, Catherine Sánchez, Jiao Jiao Li, Mojdeh Dinarvand, Hans Adomat, Mazyar Ghaffari, Leila Khoja, Fatemeh Vafaee, Anthony M Joshua, Kim N Chi, Emma S Tomlinson Guns, Elham Hosseini-Beheshti.
Journal of Cancer Research and Clinical Oncology 2022 Oct; [Epub].
Application:WB-Ce, Human, Human serum, Human urine.
-
Bladder Cancer Extracellular Vesicles Elicit a CD8 T Cell-Mediated Antitumor Immunity.
Carlos J. Ortiz-Bonilla, Taylor P. Uccello, Scott A. Gerber, Edith M. Lord, Edward M. Messing and Yi-Fen Lee.
International Journal of Molecular Sciences 2022 Mar; 23(6):2904.
Application:WB-Ce, Mouse, MB49.
-
Human thymic epithelial primary cells produce exosomes carrying tissue-restricted antigens.
Skogberg G, Lundberg V, Berglund M, Gudmundsdottir J, Telemo E, Lindgren S, Ekwall O.
Immunology and Cell Biology 2015 Sep; 93(8):948.
Application:Flow Cyt, Human, Thymic epithelial cells.
-
Characterization of human thymic exosomes.
Skogberg G, Gudmundsdottir J, van der Post S, Sandstrom K, Bruhn S, Benson M, Mincheva-Nilsson L, Baranov V, Telemo E, Ekwall O.
PLoS One 2013 Jul; 8(7):e67554.
Application:Flow Cyt, Human, Human thymic vesicles.
-
Extracellular vesicles from biological fluids as potential markers in castration resistant prostate cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com