TF monoclonal antibody (M08), clone 1C2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
TF monoclonal antibody (M08), clone 1C2. Western Blot analysis of TF expression in HeLa.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TF is 0.3 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to TF on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TF.
Immunogen
TF (AAH59367, 551 a.a. ~ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
FVKHQTVPQNTGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLARAPNHAVVTRKDKEACVHKILRQQQHLFGSNVTDCSGNFCLFRSETKDLLF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (66); Rat (63)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TF monoclonal antibody (M08), clone 1C2. Western Blot analysis of TF expression in HeLa.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TF is 0.3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to TF on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — TF
Entrez GeneID
7018GeneBank Accession#
BC059367Protein Accession#
AAH59367Gene Name
TF
Gene Alias
DKFZp781D0156, PRO1557, PRO2086
Gene Description
transferrin
Gene Ontology
HyperlinkGene Summary
This gene encodes a glycoprotein with an approximate molecular weight of 76.5 kDa. It is thought to have been created as a result of an ancient gene duplication event that led to generation of homologous C and N-terminal domains each of which binds one ion of ferric iron. The function of this protein is to transport iron from the intestine, reticuloendothelial system, and liver parenchymal cells to all proliferating cells in the body. This protein may also have a physiologic role as granulocyte/pollen-binding protein (GPBP) involved in the removal of certain organic matter and allergens from serum. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
- Abortion
- Alzheimer disease
- Anemia
- Anoxia
- Arthritis
- Asthma
- Atherosclerosis
- Birth Weight
- Brain Ischemia
+ View More Disease
-
Publication Reference
-
NF-κB-dependent increase in tissue factor expression is responsible for hypoxic podocyte injury.
Narita I, Shimada M, Yamabe H, Kinjo T, Tanno T, Nishizaki K, Kawai M, Nakamura M, Murakami R, Nakamura N, Tomita H, Saleem MA, Mathieson PW, Okumura K.
Amino Acids 2015 Dec; 20(5):679.
Application：IF, Human, Human podocytes.
-
NF-κB-dependent increase in tissue factor expression is responsible for hypoxic podocyte injury.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com