TCF12 monoclonal antibody (M01), clone 2E9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TCF12.
Immunogen
TCF12 (NP_996919, 364 a.a. ~ 453 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VGSPSPLTGTSQWPRPGGQAPSSPSYENSLHSLKNRVEQQLHEHLQDAMSFLKDVCEQSRMEDRLDRLDDAIHVLRNHAVGPSTSLPAGH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (96)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TCF12 monoclonal antibody (M01), clone 2E9 Western Blot analysis of TCF12 expression in Jurkat ( Cat # L017V1 ).Western Blot (Transfected lysate)
Western Blot analysis of TCF12 expression in transfected 293T cell line by TCF12 monoclonal antibody (M01), clone 2E9.
Lane 1: TCF12 transfected lysate(75.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TCF12 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1 ug/ml]ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of TCF12 over-expressed 293 cell line, cotransfected with TCF12 Validated Chimera RNAi ( Cat # H00006938-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TCF12 monoclonal antibody (M01), clone 2E9 (Cat # H00006938-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — TCF12
Entrez GeneID
6938GeneBank Accession#
NM_207036Protein Accession#
NP_996919Gene Name
TCF12
Gene Alias
HEB, HTF4, HsT17266, bHLHb20
Gene Description
transcription factor 12
Omim ID
600480Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the basic helix-loop-helix (bHLH) E-protein family that recognizes the consensus binding site (E-box) CANNTG. This encoded protein is expressed in many tissues, among them skeletal muscle, thymus, B- and T-cells, and may participate in regulating lineage-specific gene expression through the formation of heterodimers with other bHLH E-proteins. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq
Other Designations
helix-loop-helix transcription factor 4
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com