SP1 monoclonal antibody (M02), clone 1A5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SP1 monoclonal antibody (M02), clone 1A5. Western Blot analysis of SP1 expression in NIH/3T3 ( Cat # L018V1 ).
Western Blot (Cell lysate)
SP1 monoclonal antibody (M02), clone 1A5 Western Blot analysis of SP1 expression in Hela S3 NE ( Cat # L013V3 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SP1 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 1 ug/ml]
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SP1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SP1 is approximately 0.1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to SP1 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SP1.
Immunogen
SP1 (NP_612482, 89 a.a. ~ 198 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQ
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (95); Rat (98)
Isotype
IgG1
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SP1 monoclonal antibody (M02), clone 1A5. Western Blot analysis of SP1 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
SP1 monoclonal antibody (M02), clone 1A5 Western Blot analysis of SP1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SP1 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 1 ug/ml]Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SP1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SP1 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to SP1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — SP1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com