SNAI2 monoclonal antibody (M05), clone 3C12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
SNAI2 monoclonal antibody (M05), clone 3C12. Western Blot analysis of SNAI2 expression in human liver.
Western Blot (Cell lysate)
SNAI2 monoclonal antibody (M05), clone 3C12 Western Blot analysis of SNAI2 expression in HepG2 ( Cat # L019V1 ).
Western Blot (Cell lysate)
SNAI2 monoclonal antibody (M05), clone 3C12. Western Blot analysis of SNAI2 expression in Raw 264.7(Cat # L024V1 ).
Western Blot (Cell lysate)
SNAI2 monoclonal antibody (M05), clone 3C12. Western Blot analysis of SNAI2 expression in PC-12(Cat # L012V1 ).
Western Blot (Cell lysate)
SNAI2 monoclonal antibody (M05), clone 3C12. Western Blot analysis of SNAI2 expression in NIH/3T3(Cat # L018V1 ).
Immunofluorescence
Immunofluorescence of monoclonal antibody to SNAI2 on U-2 OS cell. [antibody concentration 10 ug/ml]
Immunofluorescence
Immunofluorescence of monoclonal antibody to SNAI2 on HepG2 cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (33.77 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SNAI2.
Immunogen
SNAI2 (NP_003059, 97 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYV
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.77 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SNAI2 monoclonal antibody (M05), clone 3C12. Western Blot analysis of SNAI2 expression in human liver.Western Blot (Cell lysate)
SNAI2 monoclonal antibody (M05), clone 3C12 Western Blot analysis of SNAI2 expression in HepG2 ( Cat # L019V1 ).Western Blot (Cell lysate)
SNAI2 monoclonal antibody (M05), clone 3C12. Western Blot analysis of SNAI2 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
SNAI2 monoclonal antibody (M05), clone 3C12. Western Blot analysis of SNAI2 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
SNAI2 monoclonal antibody (M05), clone 3C12. Western Blot analysis of SNAI2 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Recombinant protein)
ELISA
Immunofluorescence (Circulating Tumor Cell)
Immunofluorescence
Immunofluorescence of monoclonal antibody to SNAI2 on U-2 OS cell. [antibody concentration 10 ug/ml]Immunofluorescence
Immunofluorescence of monoclonal antibody to SNAI2 on HepG2 cell. [antibody concentration 10 ug/ml] -
Gene Info — SNAI2
Entrez GeneID
6591GeneBank Accession#
NM_003068Protein Accession#
NP_003059Gene Name
SNAI2
Gene Alias
MGC10182, SLUG, SLUGH1, WS2D
Gene Description
snail homolog 2 (Drosophila)
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects. [provided by RefSeq
Other Designations
OTTHUMP00000195093|neural crest transcription factor SLUG|slug (chicken homolog), zinc finger protein|slug homolog, zinc finger protein|snail 2
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com