CXCL5 monoclonal antibody (M05), clone 2A9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant CXCL5.
Immunogen
CXCL5 (AAH08376, 1 a.a. ~ 114 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLRKVIQKILDGGNKEN
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.28 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CXCL5 on formalin-fixed paraffin-embedded human smooth muscle. [antibody concentration 0.7 ug/ml]ELISA
-
Gene Info — CXCL5
Entrez GeneID
6374GeneBank Accession#
BC008376Protein Accession#
AAH08376Gene Name
CXCL5
Gene Alias
ENA-78, SCYB5
Gene Description
chemokine (C-X-C motif) ligand 5
Omim ID
600324Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an inflammatory chemokine that belongs to the CXC chemokine family. This chemokine is produced concomitantly with interleukin-8 (IL8) in response to stimulation with either interleukin-1 (IL1) or tumor necrosis factor-alpha (TNFA). This chemokine is a potent chemotaxin involved in neutrophil activation. [provided by RefSeq
Other Designations
epithelial-derived neutrophil activating protein 78|epithelial-derived neutrophil-activating peptide 78|neutrophil-activating peptide ENA-78|neutrophil-activating protein 78|small inducible cytokine B5|small inducible cytokine subfamily B (Cys-X-Cys), mem
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
CXCL5 knockdown expression inhibits human bladder cancer T24 cells proliferation and migration.
Zheng J, Zhu X, Zhang J.
Biochemical and Biophysical Research Communications 2014 Mar; 446(1):18.
Application:WB, Human, T24 cells, Bladder carcinoma.
-
CXCL5 contributes to tumour metastasis and recurrence of intrahepatic cholangiocarcinoma by recruiting infiltrative intratumoural neutrophils.
Zhou SL, Dai Z, Zhou ZJ, Chen Q, Wang Z, Xiao YS, Hu ZQ, Huang XY, Yang GH, Shi YH, Qiu SJ, Fan J, Zhou J.
Carcinogenesis 2014 Mar; 35(3):597.
Application:IF, WB-Ce, WB-Ti, Human, HIBEpiC, HCCC-9810, HuH-28, RBE cells, Intrahepatic cholangiocarcinoma.
-
Overexpression of CXCL5 mediates neutrophil infiltration and indicates poor prognosis for hepatocellular carcinoma.
Zhou SL, Dai Z, Zhou ZJ, Wang XY, Yang GH, Wang Z, Huang XW, Fan J, Zhou J.
Hepatology 2012 Dec; 56(6):2242.
Application:IF, WB-Ce, WB-Tr, Human, HepG2, PLC/PRF/5, Huh7, MHCC97L, MHCC97H, HCCLM3 cells.
-
CXCL5 knockdown expression inhibits human bladder cancer T24 cells proliferation and migration.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com