Product Browser

Last updated: 2023/5/29

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

CCL24 MaxPab mouse polyclonal antibody (B01P) MaxPab

  • Catalog # : H00006369-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human CCL24 protein.
  • Immunogen:
  • CCL24 (NP_002982, 1 a.a. ~ 119 a.a) full-length human protein.
  • Sequence:
  • MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Interspecies Antigen Sequence:
  • Mouse (59); Rat (56)
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CCL24 expression in transfected 293T cell line (H00006369-T01) by CCL24 MaxPab polyclonal antibody.

    Lane 1: CCL24 transfected lysate(13.09 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6369
  • Gene Name:
  • CCL24
  • Gene Alias:
  • Ckb-6,MPIF-2,MPIF2,SCYA24
  • Gene Description:
  • chemokine (C-C motif) ligand 24
  • Gene Summary:
  • This gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity on resting T lymphocytes, a minimal activity on neutrophils, and is negative on monocytes and activated T lymphocytes. The protein is also a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. [provided by RefSeq
  • Other Designations:
  • CK-beta-6,eotaxin-2,myeloid progenitor inhibitory factor 2,small inducible cytokine A24,small inducible cytokine subfamily A (Cys-Cys), member 24
  • RSS
  • YouTube
  • Linkedin
  • Facebook