Product Browser

Last updated: 2023/5/29

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

CCL1 MaxPab mouse polyclonal antibody (B01P) MaxPab

  • Catalog # : H00006346-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human CCL1 protein.
  • Immunogen:
  • CCL1 (NP_002972.1, 1 a.a. ~ 96 a.a) full-length human protein.
  • Sequence:
  • MQIITTALVCLLLAGMWPEDVDSKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Interspecies Antigen Sequence:
  • Mouse (42); Rat (43)
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CCL1 expression in transfected 293T cell line (H00009069-T01) by CCL1 MaxPab polyclonal antibody.

    Lane 1: CCL1 transfected lysate(11.00 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6346
  • Gene Name:
  • CCL1
  • Gene Alias:
  • I-309,P500,SCYA1,SISe,TCA3
  • Gene Description:
  • chemokine (C-C motif) ligand 1
  • Gene Summary:
  • This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine is secreted by activated T cells and displays chemotactic activity for monocytes but not for neutrophils. It binds to the chemokine receptor CCR8. [provided by RefSeq
  • Other Designations:
  • T lymphocyte-secreted protein I-309,inflammatory cytokine I-309,small inducible cytokine A1,small inducible cytokine A1 (I-309, homologous to mouse Tca-3)
  • RSS
  • YouTube
  • Linkedin
  • Facebook