Product Browser

Last updated: 2023/1/22
  • Related Product Showcase
  • By Research Area
  • By Pathway
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

MAPK12 monoclonal antibody (M06), clone 1G3 

  • Catalog # : H00006300-M06
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant MAPK12.
  • Immunogen:
  • MAPK12 (AAH15741, 251 a.a. ~ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • QRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006300-M06
    Western Blot detection against Immunogen (38.61 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Interspecies Antigen Sequence:
  • Mouse (88); Rat (90)
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • MAPK12 monoclonal antibody (M06), clone 1G3 Western Blot analysis of MAPK12 expression in K-562 ( Cat # L009V1 ).
  • PDF DownloadProtocol Download
  • Immunofluorescence
  • Immunofluorescence enlargeenlarge this image
  • Immunofluorescence of monoclonal antibody to MAPK12 on HeLa cell. [antibody concentration 25 ug/ml]
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6300
  • Gene Name:
  • MAPK12
  • Gene Alias:
  • ERK3,ERK6,P38GAMMA,PRKM12,SAPK-3,SAPK3
  • Gene Description:
  • mitogen-activated protein kinase 12
  • Gene Summary:
  • Activation of members of the mitogen-activated protein kinase family is a major mechanism for transduction of extracellular signals. Stress-activated protein kinases are one subclass of MAP kinases. The protein encoded by this gene functions as a signal transducer during differentiation of myoblasts to myotubes. [provided by RefSeq
  • Other Designations:
  • mitogen-activated protein kinase 3,stress-activated protein kinase 3
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook