POLR2H monoclonal antibody (M01), clone 3G6-1A4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
POLR2H monoclonal antibody (M01), clone 3G6-1A4 Western Blot analysis of POLR2H expression in Hela ( Cat # L013V1 ).
Western Blot (Cell lysate)
POLR2H monoclonal antibody (M01), clone 3G6-1A4. Western Blot analysis of POLR2H expression in HepG2 ( Cat # L019V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of POLR2H expression in transfected 293T cell line by POLR2H monoclonal antibody (M01), clone 3G6-1A4.
Lane 1: POLR2H transfected lysate(17.1 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged POLR2H is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (42.24 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant POLR2H.
Immunogen
POLR2H (AAH00739, 1 a.a. ~ 150 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (42.24 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
POLR2H monoclonal antibody (M01), clone 3G6-1A4 Western Blot analysis of POLR2H expression in Hela ( Cat # L013V1 ).Western Blot (Cell lysate)
POLR2H monoclonal antibody (M01), clone 3G6-1A4. Western Blot analysis of POLR2H expression in HepG2 ( Cat # L019V1 ).Western Blot (Transfected lysate)
Western Blot analysis of POLR2H expression in transfected 293T cell line by POLR2H monoclonal antibody (M01), clone 3G6-1A4.
Lane 1: POLR2H transfected lysate(17.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged POLR2H is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — POLR2H
Entrez GeneID
5437GeneBank Accession#
BC000739Protein Accession#
AAH00739Gene Name
POLR2H
Gene Alias
RPABC3, RPB17, RPB8, hsRPB8
Gene Description
polymerase (RNA) II (DNA directed) polypeptide H
Omim ID
606023Gene Ontology
HyperlinkGene Summary
This gene encodes one of the essential subunits of RNA polymerase II that is shared by the other two eukaryotic DNA-directed RNA polymerases, I and III. [provided by RefSeq
Other Designations
RNA polymerase II, polypeptide H
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Examining the complexity of human RNA polymerase complexes using HaloTag technology coupled to label free quantitative proteomics.
Daniels DL, Méndez J, Mosley AL, Ramisetty SR, Murphy N, Benink H, Wood KV, Urh M, Washburn MP.
Journal of Proteome Research 2012 Feb; 11(2):564.
Application：WB-Tr, Human, HEK 293T cells.
-
Examining the complexity of human RNA polymerase complexes using HaloTag technology coupled to label free quantitative proteomics.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com