SERPINA1 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
SERPINA1 MaxPab rabbit polyclonal antibody. Western Blot analysis of SERPINA1 expression in human stomach.
Western Blot (Transfected lysate)
Western Blot analysis of SERPINA1 expression in transfected 293T cell line (H00005265-T01) by SERPINA1 MaxPab polyclonal antibody.
Lane 1: SERPINA1 transfected lysate(46.7 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of SERPINA1 transfected lysate using anti-SERPINA1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with SERPINA1 MaxPab mouse polyclonal antibody (B01) (H00005265-B01).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human SERPINA1 protein.
Immunogen
SERPINA1 (AAH15642.1, 1 a.a. ~ 418 a.a) full-length human protein.
Sequence
MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQATTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SERPINA1 MaxPab rabbit polyclonal antibody. Western Blot analysis of SERPINA1 expression in human stomach.Western Blot (Transfected lysate)
Western Blot analysis of SERPINA1 expression in transfected 293T cell line (H00005265-T01) by SERPINA1 MaxPab polyclonal antibody.
Lane 1: SERPINA1 transfected lysate(46.7 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of SERPINA1 transfected lysate using anti-SERPINA1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with SERPINA1 MaxPab mouse polyclonal antibody (B01) (H00005265-B01). -
Gene Info — SERPINA1
Entrez GeneID
5265GeneBank Accession#
BC015642.2Protein Accession#
AAH15642.1Gene Name
SERPINA1
Gene Alias
A1A, A1AT, AAT, MGC23330, MGC9222, PI, PI1, PRO2275
Gene Description
serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is secreted and is a serine protease inhibitor whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. Defects in this gene can cause emphysema or liver disease. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
protease inhibitor 1 (anti-elastase), alpha-1-antitrypsin|serine (or cysteine) proteinase inhibitor, clade A, member 1|serine proteinase inhibitor, clade A, member 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com