PHB (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PHB full-length ORF ( AAH13401, 1 a.a. - 272 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVVFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAGDIAYQLSRSRNITYLPAGQSVLLQLPQ
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
55.66
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PHB
Entrez GeneID
5245GeneBank Accession#
BC013401Protein Accession#
AAH13401Gene Name
PHB
Gene Alias
PHB1
Gene Description
prohibitin
Omim ID
176705Gene Ontology
HyperlinkGene Summary
Prohibitin is an evolutionarily conserved gene that is ubiquitously expressed. It is thought to be a negative regulator of cell proliferation and may be a tumor suppressor. Mutations in PHB have been linked to sporadic breast cancer. Prohibitin is expressed as two transcripts with varying lengths of 3' untranslated region. The longer transcript is present at higher levels in proliferating tissues and cells, suggesting that this longer 3' untranslated region may function as a trans-acting regulatory RNA. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
-
Publication Reference
-
Activation of AMP-activated protein kinase (AMPK) through inhibiting interaction with prohibitins.
Shuhei Kanagaki, Yusuke Tsutsui, Naoki Kobayashi, Takashi Komine, Minoru Ito, Yunike Akasaka, Michiaki Nagasawa, Tomohiro Ide, Naoki Omae, Kazuhisa Nakao, Makoto Rembutsu, Maki Iwago, Aki Yonezawa, Yusei Hosokawa, Tetsuya Hosooka, Wataru Ogawa, Koji Murakami.
iScience 2023 Feb; 26(4):106293.
Application:Pull-Down, Recombinant proteins.
-
C9orf72 regulates energy homeostasis by stabilizing mitochondrial complex I assembly.
Tao Wang, Honghe Liu, Kie Itoh, Sungtaek Oh, Liang Zhao, Daisuke Murata, Hiromi Sesaki, Thomas Hartung, Chan Hyun Na, Jiou Wang.
Cell Metabolism 2021 Mar; 33(3):531.
Application:PI, WB-Re, Recombinant proteins.
-
Prohibitin interacts with phosphatidylinositol 3,4,5-triphosphate (PIP3) and modulates insulin signaling.
Ande SR, Mishra S.
Biochemical and Biophysical Research Communications 2009 Dec; 390(3):1023.
Application:Func, WB-Re, WB-Re.
-
Activation of AMP-activated protein kinase (AMPK) through inhibiting interaction with prohibitins.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com