PHB monoclonal antibody (M01), clone 3F4-2B2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant PHB.
Immunogen
PHB (AAH13401, 1 a.a. ~ 272 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVVFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAGDIAYQLSRSRNITYLPAGQSVLLQLPQ
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG2a kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (55.66 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PHB monoclonal antibody (M01), clone 3F4-2B2 Western Blot analysis of PHB expression in Hela ( Cat # L013V1 ).Western Blot (Cell lysate)
PHB monoclonal antibody (M01), clone 3F4-2B2. Western Blot analysis of PHB expression in NIH/3T3.Western Blot (Cell lysate)
PHB monoclonal antibody (M01), clone 3F4-2B2. Western Blot analysis of PHB expression in PC-12.Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PHB on formalin-fixed paraffin-embedded human tonsil tissue.[antibody concentration 5 ug/ml]Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PHB on formalin-fixed paraffin-embedded human colon adenocarcinoma. [antibody concentration 5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PHB is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PHB on HeLa cell. [antibody concentration 1 ~ 10 ug/ml] -
Gene Info — PHB
Entrez GeneID
5245GeneBank Accession#
BC013401Protein Accession#
AAH13401Gene Name
PHB
Gene Alias
PHB1
Gene Description
prohibitin
Omim ID
176705Gene Ontology
HyperlinkGene Summary
Prohibitin is an evolutionarily conserved gene that is ubiquitously expressed. It is thought to be a negative regulator of cell proliferation and may be a tumor suppressor. Mutations in PHB have been linked to sporadic breast cancer. Prohibitin is expressed as two transcripts with varying lengths of 3' untranslated region. The longer transcript is present at higher levels in proliferating tissues and cells, suggesting that this longer 3' untranslated region may function as a trans-acting regulatory RNA. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
-
Publication Reference
-
Gonad differential proteins revealed with proteomics in oyster (Saccostrea cucullata) using alga as food contaminated with cadmium.
Zhu B, Gao KS, Wang KJ, Ke CH, Huang HQ.
Chemosphere 2012 Jan; 87(4):397.
Application:WB, Oyster(Saccostreacucullata), oyster gonad.
-
Gonad differential proteins revealed with proteomics in oyster (Saccostrea cucullata) using alga as food contaminated with cadmium.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com