PF4 monoclonal antibody (M01), clone 3F6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PF4 expression in transfected 293T cell line by PF4 monoclonal antibody (M01), clone 3F6.
Lane 1: PF4 transfected lysate(10.8 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of PF4 transfected lysate using anti-PF4 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PF4 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PF4 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (33.55 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PF4.
Immunogen
PF4 (NP_002610, 31 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.55 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PF4 expression in transfected 293T cell line by PF4 monoclonal antibody (M01), clone 3F6.
Lane 1: PF4 transfected lysate(10.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of PF4 transfected lysate using anti-PF4 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PF4 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PF4 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — PF4
Entrez GeneID
5196GeneBank Accession#
NM_002619Protein Accession#
NP_002610Gene Name
PF4
Gene Alias
CXCL4, MGC138298, SCYB4
Gene Description
platelet factor 4
Omim ID
173460Gene Ontology
HyperlinkGene Summary
Platelet factor-4 is a 70-amino acid protein that is released from the alpha-granules of activated platelets and binds with high affinity to heparin. Its major physiologic role appears to be neutralization of heparin-like molecules on the endothelial surface of blood vessels, thereby inhibiting local antithrombin III activity and promoting coagulation. As a strong chemoattractant for neutrophils and fibroblasts, PF4 probably has a role in inflammation and wound repair (Eisman et al., 1990 [PubMed 1695112]).[supplied by OMIM
Other Designations
chemokine (C-X-C motif) ligand 4|platelet factor 4 (chemokine (C-X-C motif) ligand 4)
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com