Product Browser

Last updated: 2023/1/22
  • Related Product Showcase
  • By Research Area
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

PCTK1 monoclonal antibody (M02), clone 2E5 

  • Catalog # : H00005127-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant PCTK1.
  • Immunogen:
  • PCTK1 (AAH01048, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MDRMKKIKRQLSMTLRGGRGIDKTNGAPEQIGLDESGGGGGSDPGEAPTRAAPGELRSARGPLSSAPEIVHEDLKMGSDG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005127-M02
    Western Blot detection against Immunogen (34.21 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PCTK1 expression in transfected 293T cell line by PCTK1 monoclonal antibody (M02), clone 2E5.

    Lane 1: PCTK1 transfected lysate (Predicted MW: 55.7 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunofluorescence
  • Immunofluorescence enlargeenlarge this image
  • Immunofluorescence of monoclonal antibody to PCTK1 on HeLa cell . [antibody concentration 10 ug/ml]
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of PCTK1 transfected lysate using anti-PCTK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PCTK1 MaxPab rabbit polyclonal antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5127
  • Gene Name:
  • PCTK1
  • Gene Alias:
  • FLJ16665,PCTAIRE,PCTAIRE1,PCTGAIRE
  • Gene Description:
  • PCTAIRE protein kinase 1
  • Gene Summary:
  • The protein encoded by this gene belongs to the cdc2/cdkx subfamily of the ser/thr family of protein kinases. It may play a role in signal transduction cascades in terminally differentiated cells. This gene is thought to escape X inactivation. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000023208,OTTHUMP00000023209,PCTAIRE-motif protein kinase 1,serine/threonine-protein kinase
  • RSS
  • YouTube
  • Linkedin
  • Facebook