PCDH1 monoclonal antibody (M01), clone 5D5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PCDH1.
Immunogen
PCDH1 (NP_002578, 62 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
YKVPEEQPPNTLIGSLAADYGFPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFA
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PCDH1 monoclonal antibody (M01), clone 5D5 Western Blot analysis of PCDH1 expression in A-431 ( Cat # L015V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PCDH1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PCDH1 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PCDH1 on A-431 cell. [antibody concentration 10 ug/ml] -
Gene Info — PCDH1
Entrez GeneID
5097GeneBank Accession#
NM_002587Protein Accession#
NP_002578Gene Name
PCDH1
Gene Alias
FLJ53887, MGC45991, PC42, PCDH42
Gene Description
protocadherin 1
Omim ID
603626Gene Ontology
HyperlinkGene Summary
This gene belongs to the protocadherin subfamily within the cadherin superfamily. The encoded protein is a membrane protein found at cell-cell boundaries. It is involved in neural cell adhesion, suggesting a possible role in neuronal development. The protein includes an extracelllular region, containing 7 cadherin-like domains, a transmembrane region and a C-terminal cytoplasmic region. Cells expressing the protein showed cell aggregation activity. Alternative splicing occurs in this gene. [provided by RefSeq
Other Designations
OTTHUMP00000160067|cadherin-like 1|cadherin-like protein 1|protocadherin 42
-
Interactome
-
Publication Reference
-
Protocadherin-1 is expressed in the notochord of mouse embryo but is dispensable for its formation.
Kanako Fukunaga, Masafumi Tanji, Nana Hanzawa, Hiroki Kuroda, Masafumi Inui.
Biochemistry and Biophysics Reports 2021 Jun; 27:101047.
Application:IF, IHC-Fr, WB-Ti, WB-Tr, Mouse, Mouse embryos, Mouse liver.
-
Protocadherin-1 Localization and Cell-Adhesion Function in Airway Epithelial Cells in Asthma.
Faura Tellez G, Willemse BW, Brouwer U, Nijboer-Brinksma S, Vandepoele K, Noordhoek JA, Heijink I, de Vries M, Smithers NP, Postma DS, Timens W, Wiffen L, van Roy F, Holloway JW, Lackie PM, Nawijn MC, Koppelman GH.
PLoS One 2016 Oct; 11(10):e0163967.
Application:IF, IHC, Human, Human bronchial epithelial cells 16HBE, asthmatic patients.
-
Identification of PCDH1 as a Novel Susceptibility Gene for Bronchial Hyperresponsiveness.
Koppelman GH, Meyers DA, Howard TD, Zheng SL, Hawkins GA, Ampleford EJ, Xu J, Koning H, Bruinenberg M, Nolte IM, van Diemen CC, Boezen HM, Timens W, Whittaker PA, Stine OC, Barton SJ, Holloway JW, Holgate ST, Graves PE, Martinez FD, van Oosterhout A, Blee.
American Journal of Respiratory and Critical Care Medicine 2009 Nov; 180(10):929.
Application:IHC, WB-Ce, Human, Airway wall biopsy, Brain, Airway epithelial cell lines, Lungs, Primary epithelial cells.
-
Protocadherin-1 is expressed in the notochord of mouse embryo but is dispensable for its formation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com