PBX1 monoclonal antibody (M01), clone 4A2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PBX1 monoclonal antibody (M01), clone 4A2 Western Blot analysis of PBX1 expression in Hela S3 NE ( Cat # L013V3 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PBX1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PBX1 is approximately 0.03ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to PBX1 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.73 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PBX1.
Immunogen
PBX1 (NP_002576, 213 a.a. ~ 321 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PBX1 monoclonal antibody (M01), clone 4A2 Western Blot analysis of PBX1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PBX1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PBX1 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PBX1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PBX1
Entrez GeneID
5087GeneBank Accession#
NM_002585Protein Accession#
NP_002576Gene Name
PBX1
Gene Alias
DKFZp686B09108, MGC126627
Gene Description
pre-B-cell leukemia homeobox 1
Omim ID
176310Gene Ontology
HyperlinkOther Designations
Pre-B cell leukemia transcription factor-1|pre-B-cell leukemia transcription factor 1
-
Interactome
-
Disease
-
Publication Reference
-
Histological and immunohistochemical analysis of epithelial cells in epidermoid cysts in intrapancreatic accessory spleen.
Satoshi Sumida, Mayuko Ichimura-Shimizu, Yuko Miyakami, Takumi Kakimoto, Tomoko Kobayashi, Yasuyo Saijo, Minoru Matsumoto, Hirohisa Ogawa, Takeshi Oya, Yoshimi Bando, Hisanori Uehara, Shu Taira, Mitsuo Shimada, Koichi Tsuneyama.
The Journal of Medical Investigation 2023 Feb; 70(1.2):251.
Application：IHC-P, Human, Human spleen.
-
Spindle function and Wnt pathway inhibition by PBX1 to suppress tumor progression via downregulating DCDC2 in colorectal cancer.
Weigang Dai, Yinan Liu, Tianhao Zhang, Zhixin Huang, Xiang Xu, Zeyu Zhao, Jianqiu Liu, Ertao Zhai, Shirong Cai, Jianhui Chen.
Oncogenesis 2023 Feb; 12(1):3.
Application：ChIP, Human, HCT116, LoVo cells.
-
m 6 A-mediated regulation of PBX1-GCH1 axis promotes gastric cancer proliferation and metastasis by elevating tetrahydrobiopterin levels.
Yinan Liu, Ertao Zhai, Junting Chen, Yan Qian, Risheng Zhao, Yan Ma, Jianqiu Liu, Zhixin Huang, Shirong Cai, Jianhui Chen.
Cancer Communications (London, England) 2022 Apr; 42(4):327.
Application：ChIP, Human, Human gastric cancer.
-
Development of small molecule inhibitors targeting PBX1 transcription signaling as a novel cancer therapeutic strategy.
Yao-An Shen, Jin Jung, Geoffrey D Shimberg, Fang-Chi Hsu, Yohan Suryo Rahmanto, Stephanie L Gaillard, Jiaxin Hong, Jürgen Bosch, Ie-Ming Shih, Chi-Mu Chuang, Tian-Li Wang.
iScience 2021 Oct; 24(11):103297.
Application：WB-Ce, WB-Ti, Human, Mouse, Human Adrenal, Bladder, Colon, Kidney, Liver, Lung, Ovary, Pancrease, Spleen, Stomach, Testes, Thyumus, Thyroid, Mouse Brain, Heart, Kidney, Liver, Lung, Muscle, Spleen, Splenocyte, A2780, SKOV3, OV.
-
PI3K Inhibition Activates SGK1 via a Feedback Loop to Promote Chromatin-Based Regulation of ER-Dependent Gene Expression.
Toska E, Castel P, Chhangawala S, Arruabarrena-Aristorena A, Chan C, Hristidis VC, Cocco E, Sallaku M, Xu G, Park J, Minuesa G, Shifman SG, Socci ND, Koche R, Leslie CS, Scaltriti M, Baselga J.
Cell Reports 2019 Apr; 27(1):294.
Application：ChIP, Human, T-47D cells.
-
Overexpression of lipid metabolism genes and PBX1 in the contralateral breasts of women with estrogen receptor-negative breast cancer.
Wang J, Shidfar A, Ivancic D, Ranjan M, Liu L, Choi MR, Parimi V, Gursel DB, Sullivan ME, Najor MS, Abukhdeir AM, Scholtens D, Khan SA.
International Journal of Cancer 2017 Jun; 140(11):2484.
Application：IHC-P, WB, Human, Human breast cancer, MCF-10A, MDA-MB-453, T47D, ZR-75-1 cells.
-
PBX3 is a putative biomarker of aggressive prostate cancer.
Ramberg H, Grytli HH, Nygård S, Wang W, Ögren O, Zhao S, Løvf M, Katz B, Skotheim RI, Bjartell A, Eri LM, Berge V, Svindland A, Taskén KA.
International Journal of Cancer 2016 Oct; 139(8):1810.
Application：IHC-P, Human, Human prostate cancer.
-
The Histone Variant MacroH2A1.2 Is Necessary for the Activation of Muscle Enhancers and Recruitment of the Transcription Factor Pbx1.
DellOrso S, Wang AH, Shih HY, Saso K, Berghella L, Gutierrez-Cruz G, Ladurner AG, OShea JJ, Sartorelli V, Zare H.
Cell Reports 2016 Feb; 14(5):1156.
Application：ChIP, IP, PI, WB-Tr, Human, Mouse, C2C12, HEK 293T cells, Recombinant protein.
-
Differential epigenetic reprogramming in response to specific endocrine therapies promotes cholesterol biosynthesis and cellular invasion.
Nguyen VT, Barozzi I, Faronato M, Lombardo Y, Steel JH, Patel N, Darbre P, Castellano L, Győrffy B, Woodley L, Meira A, Patten DK, Vircillo V, Periyasamy M, Ali S, Frige G, Minucci S, Coombes RC, Magnani L.
Nature Communications 2015 Nov; 6:10044.
Application：IHC-P, Human, Bone marrow, Lymph nodes.
-
PBX1 Genomic Pioneer Function Drives ER alpha Signaling Underlying Progression in Breast Cancer.
Magnani L, Ballantyne EB, Zhang X, Lupien M.
PLoS Genetics 2011 Nov; 7(11):e1002368.
Application：IF, ChIP, WB-Ce, WB-Tr, Human, MCF-7, MDA-MB-231 cells.
-
Cooperative transcriptional activation by klf4, meis2, and pbx1.
Bjerke GA, Hyman-Walsh C, Wotton D.
Molecular and Cellular Biology 2011 Sep; 31(18):3723.
Application：WB-Tr, Monkey, Human, COS-1, MCF-7 cells.
-
Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation.
Cheung CL, Chan BY, Chan V, Ikegawa S, Kou I, Ngai H, Smith D, Luk KD, Huang QY, Mori S, Sham PC, Kung AW.
Human Molecular Genetics 2009 Feb; 18(4):679.
Application：IF, WB-Ce, WB-Tr, Mouse, Human bone-derived cells, MC3T3-E1 cells.
-
Histological and immunohistochemical analysis of epithelial cells in epidermoid cysts in intrapancreatic accessory spleen.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com