PAK3 monoclonal antibody (M08), clone 3A12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PAK3.
Immunogen
PAK3 (NP_002569, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGE
Host
Mouse
Reactivity
Human, Mouse
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PAK3 monoclonal antibody (M08), clone 3A12 Western Blot analysis of PAK3 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Recombinant protein)
ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PAK3 on NIH/3T3 cell. [antibody concentration 10 ug/ml] -
Gene Info — PAK3
Entrez GeneID
5063GeneBank Accession#
NM_002578Protein Accession#
NP_002569Gene Name
PAK3
Gene Alias
CDKN1A, MRX30, MRX47, OPHN3, PAK3beta, bPAK, hPAK3
Gene Description
p21 protein (Cdc42/Rac)-activated kinase 3
Gene Ontology
HyperlinkGene Summary
PAK proteins are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. PAK proteins, a family of serine/threonine p21-activating kinases, serve as targets for the small GTP binding proteins Cdc42 and RAC and have been implicated in a wide range of biological activities. The protein encoded by this gene forms an activated complex with GTP-bound RAS-like (P21), CDC2 and RAC1 proteins which then catalyzes a variety of targets. This protein may be necessary for dendritic development and for the rapid cytoskeletal reorganization in dendritic spines associated with synaptic plasticity. Defects in this gene are the cause of non-syndromic mental retardation X-linked type 30 (MRX30), also called X-linked mental retardation type 47 (MRX47). Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000023855|OTTHUMP00000062894|beta-PAK|oligophrenin-3|p21 (CDKN1A)-activated kinase 3|p21-activated kinase 3|p21-activated kinase-3|serine/threonine-protein kinase PAK 3
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
P21-Activated Kinase Inhibitors FRAX486 and IPA3: Inhibition of Prostate Stromal Cell Growth and Effects on Smooth Muscle Contraction in the Human Prostate.
Wang Y, Gratzke C, Tamalunas A, Wiemer N, Ciotkowska A, Rutz B, Waidelich R, Strittmatter F, Liu C, Stief CG, Hennenberg M.
PLoS One 2016 Apr; 11(4):e0153312.
Application:WB-Ce, WB-Ti, Human, Prostate, WPMY-1 cells.
-
P21-Activated Kinase Inhibitors FRAX486 and IPA3: Inhibition of Prostate Stromal Cell Growth and Effects on Smooth Muscle Contraction in the Human Prostate.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com