MYL4 monoclonal antibody (M01), clone 1A11-C8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (47.41 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant MYL4.
Immunogen
MYL4 (AAH30228, 1 a.a. ~ 197 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (47.41 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — MYL4
Entrez GeneID
4635GeneBank Accession#
BC030228Protein Accession#
AAH30228Gene Name
MYL4
Gene Alias
ALC1, AMLC, GT1, PRO1957
Gene Description
myosin, light chain 4, alkali; atrial, embryonic
Omim ID
160770Gene Ontology
HyperlinkGene Summary
Myosin is a hexameric ATPase cellular motor protein. It is composed of two myosin heavy chains, two nonphosphorylatable myosin alkali light chains, and two phosphorylatable myosin regulatory light chains. This gene encodes a myosin alkali light chain that is found in embryonic muscle and adult atria. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
atrial/embryonic alkali myosin light chain|myosin, atrial/fetal muscle, light chain|myosin, light polypeptide 4, alkali; atrial, embryonic
-
Interactome
-
Pathway
-
Publication Reference
-
Myosin light-chain 4 gene-transfer attenuates atrial fibrosis while correcting autophagic flux dysregulation.
Yuan Zhong, Kai Tang, Stanley Nattel, Ming Zhai, Shiyu Gong, Qing Yu, Yanxi Zeng, Guangxi E, Nuerbiyemu Maimaitiaili, Jun Wang, Yawei Xu, Wenhui Peng, Hailing Li.
Redox Biology 2023 Jan; 60:102606.
Application：WB, Rat, Rat atrium, Rat primary neonatal atrial cardiomyocytes (NRAMs).
-
Embryonic Essential Myosin Light Chain Regulates Fetal Lung Development in Rats.
Santos M, Moura RS, Gonzaga S, Nogueira-Silva C, Ohlmeier S, Correia-Pinto J.
American Journal of Respiratory Cell and Molecular Biology 2007 May; 37(3):330.
Application：IHC-P, WB, Rat, Rat lung.
-
Myosin light-chain 4 gene-transfer attenuates atrial fibrosis while correcting autophagic flux dysregulation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com