Product Browser

Last updated: 2023/3/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

MTCP1 MaxPab mouse polyclonal antibody (B02P) MaxPab

  • Catalog # : H00004515-B02P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human MTCP1 protein.
  • Immunogen:
  • MTCP1 (NP_001018024, 1 a.a. ~ 68 a.a) full-length human protein.
  • Sequence:
  • MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of MTCP1 expression in transfected 293T cell line (H00004515-T02) by MTCP1 MaxPab polyclonal antibody.

    Lane 1: MTCP1 transfected lysate(7.48 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4515
  • Gene Name:
  • MTCP1
  • Gene Alias:
  • C6.1B,P13MTCP1
  • Gene Description:
  • mature T-cell proliferation 1
  • Gene Summary:
  • This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the upstream 13 kDa protein that is a member of the TCL1 family. This protein may be involved in leukemogenesis. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000015489,OTTHUMP00000015491,OTTHUMP00000015492,OTTHUMP00000024241,OTTHUMP00000082776
  • RSS
  • YouTube
  • Linkedin
  • Facebook