SMAD2 monoclonal antibody (M07), clone 2D7

Catalog # H00004087-M07

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

SMAD2 monoclonal antibody (M07), clone 2D7 Western Blot analysis of SMAD2 expression in HeLa ( Cat # L013V1 ).

Sandwich ELISA (Recombinant protein)
Application

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged SMAD2 is approximately 0.3ng/ml as a capture antibody.

<em>In situ</em> Proximity Ligation Assay (Cell)
Application

In situ Proximity Ligation Assay (Cell)

Proximity Ligation Analysis of protein-protein interactions between CAMK2A and SMAD2. HeLa cells were stained with anti-CAMK2A rabbit purified polyclonal 1:1200 and anti-SMAD2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

QC Test

Western Blot detection against Immunogen (36.63 KDa) .

  • Specification

    Product Description

    Mouse monoclonal antibody raised against a partial recombinant SMAD2.

    Immunogen

    SMAD2 (AAH25699, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYY

    Host

    Mouse

    Reactivity

    Human

    Interspecies Antigen Sequence

    Rat (100)

    Isotype

    IgG2a Kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (36.63 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Cell lysate)

    SMAD2 monoclonal antibody (M07), clone 2D7 Western Blot analysis of SMAD2 expression in HeLa ( Cat # L013V1 ).

    Western Blot (Recombinant protein)

    Sandwich ELISA (Recombinant protein)

    Detection limit for recombinant GST tagged SMAD2 is approximately 0.3ng/ml as a capture antibody.

    ELISA

    In situ Proximity Ligation Assay (Cell)

    Proximity Ligation Analysis of protein-protein interactions between CAMK2A and SMAD2. HeLa cells were stained with anti-CAMK2A rabbit purified polyclonal 1:1200 and anti-SMAD2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
  • Gene Info — SMAD2

    Entrez GeneID

    4087

    GeneBank Accession#

    BC025699

    Protein Accession#

    AAH25699

    Gene Name

    SMAD2

    Gene Alias

    JV18, JV18-1, MADH2, MADR2, MGC22139, MGC34440, hMAD-2, hSMAD2

    Gene Description

    SMAD family member 2

    Omim ID

    601366

    Gene Ontology

    Hyperlink

    Gene Summary

    The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signal of the transforming growth factor (TGF)-beta, and thus regulates multiple cellular processes, such as cell proliferation, apoptosis, and differentiation. This protein is recruited to the TGF-beta receptors through its interaction with the SMAD anchor for receptor activation (SARA) protein. In response to TGF-beta signal, this protein is phosphorylated by the TGF-beta receptors. The phosphorylation induces the dissociation of this protein with SARA and the association with the family member SMAD4. The association with SMAD4 is important for the translocation of this protein into the nucleus, where it binds to target promoters and forms a transcription repressor complex with other cofactors. This protein can also be phosphorylated by activin type 1 receptor kinase, and mediates the signal from the activin. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq

    Other Designations

    MAD, mothers against decapentaplegic homolog 2|Mad protein homolog|Mad, mothers against decapentaplegic homolog 2|Mad-related protein 2|SMAD, mothers against DPP homolog 2|Sma- and Mad-related protein 2|mother against DPP homolog 2

  • Interactome
  • Pathway
  • Disease
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All