LDHC purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human LDHC protein.
Immunogen
LDHC (NP_002292.1, 1 a.a. ~ 332 a.a) full-length human protein.
Sequence
MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of LDHC expression in transfected 293T cell line (H00003948-T02) by LDHC MaxPab polyclonal antibody.
Lane 1: LDHC transfected lysate(36.30 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of LDHC transfected lysate using anti-LDHC MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with LDHC purified MaxPab mouse polyclonal antibody (B01P) (H00003948-B01P). -
Gene Info — LDHC
Entrez GeneID
3948GeneBank Accession#
NM_002301.2Protein Accession#
NP_002292.1Gene Name
LDHC
Gene Alias
CT32, LDH3, LDHX, MGC111073
Gene Description
lactate dehydrogenase C
Omim ID
150150Gene Ontology
HyperlinkGene Summary
Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family. Two transcript variants have been detected which differ in the 5' untranslated region. [provided by RefSeq
Other Designations
L-lactate dehydrogenase C|cancer/testis antigen 32
-
Interactome
-
Pathway
-
Publication Reference
-
RAB-like 2 has an essential role in male fertility, sperm intra-flagellar transport, and tail assembly.
Lo JC, Jamsai D, O'Connor AE, Borg C, Clark BJ, Whisstock JC, Field MC, Adams V, Ishikawa T, Aitken RJ, Whittle B, Goodnow CC, Ormandy CJ, O'Bryan MK.
PLoS Genetics 2012 Oct; 8(10):e1002969.
Application:IP, WB, Mouse, Mouse testis.
-
RAB-like 2 has an essential role in male fertility, sperm intra-flagellar transport, and tail assembly.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com