INPPL1 monoclonal antibody (M01), clone 3E6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
INPPL1 monoclonal antibody (M01), clone 3E6 Western Blot analysis of INPPL1 expression in HeLa ( Cat # L013V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged INPPL1 is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant INPPL1.
Immunogen
INPPL1 (NP_001558, 1159 a.a. ~ 1258 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PSDYGRPLSFPPPRIRESIQEDLAEEAPCLQGGRASGLGEAGMSAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
INPPL1 monoclonal antibody (M01), clone 3E6 Western Blot analysis of INPPL1 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged INPPL1 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — INPPL1
Entrez GeneID
3636GeneBank Accession#
NM_001567Protein Accession#
NP_001558Gene Name
INPPL1
Gene Alias
SHIP2
Gene Description
inositol polyphosphate phosphatase-like 1
Omim ID
600829Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an SH2-containing 5'-inositol phosphatase that is involved in the regulation of insulin function. The encoded protein also plays a role in the regulation of epidermal growth factor receptor turnover and actin remodelling. Additionally, this gene supports metastatic growth in breast cancer and is a valuable biomarker for breast cancer. [provided by RefSeq
Other Designations
51C protein
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
FBP17 and CIP4 recruit SHIP2 and lamellipodin to prime the plasma membrane for fast endophilin-mediated endocytosis.
Chan Wah Hak L, Khan S, Di Meglio I, Law AL, Häsler SL, Quintaneiro LM, Ferreira APA, Krause M, McMahon HT, Boucrot E.
Nature Cell Biology 2018 Sep; 20(9):1023.
Application：IS, WB, Monkey, BSC1 cells.
-
FBP17 and CIP4 recruit SHIP2 and lamellipodin to prime the plasma membrane for fast endophilin-mediated endocytosis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com