ILF2 monoclonal antibody (M01), clone 1E2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ILF2.
Immunogen
ILF2 (NP_004506, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ILF2 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — ILF2
Entrez GeneID
3608GeneBank Accession#
NM_004515Protein Accession#
NP_004506Gene Name
ILF2
Gene Alias
MGC8391, NF45, PRO3063
Gene Description
interleukin enhancer binding factor 2, 45kDa
Omim ID
603181Gene Ontology
HyperlinkGene Summary
Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of the interleukin 2 gene. NFAT binds to a sequence in the interleukin 2 gene enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the smaller of which is the product of this gene. The encoded protein binds strongly to the 90 kDa protein and stimulates its ability to enhance gene expression. [provided by RefSeq
Other Designations
interleukin enhancer binding factor 2|nuclear factor of activated T-cells, 45-kDa
-
Interactome
-
Publication Reference
-
Dynamic interplay between O-GlcNAcylation and GSK-3-dependent phosphorylation.
Wang Z, Pandey A, Hart GW.
Molecular & Cellular Proteomics 2007 May; 6(8):1365.
Application:IP-WB, Human, COS7 cells.
-
Dynamic interplay between O-GlcNAcylation and GSK-3-dependent phosphorylation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com