Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

IL1R1 DNAxPab DNAxPabDNAxPab

  • Catalog # : H00003554-W01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a partial-length human IL1R1 DNA using DNAx™ Immune technology.
  • Immunogen:
  • IL1R1 (NP_000868.1, 18 a.a. ~ 336 a.a) partial-length human DNA
  • Sequence:
  • LEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQK
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Purification:
  • Protein A
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Immunofluorescence (Transfected cell)
  • Flow Cytometry (Transfected cell)
  • Application Image
  • Immunofluorescence (Transfected cell)
  • Flow Cytometry (Transfected cell)
  • Gene Information
  • Entrez GeneID:
  • 3554
  • Gene Name:
  • IL1R1
  • Gene Alias:
  • CD121A,D2S1473,IL-1R-alpha,IL1R,IL1RA,P80
  • Gene Description:
  • interleukin 1 receptor, type I
  • Gene Summary:
  • The protein encoded by this gene is a cytokine receptor that belongs to the interleukin 1 receptor family. This protein is a receptor for interleukin alpha (IL1A), interleukin beta (IL1B), and interleukin 1 receptor, type I(IL1R1/IL1RA). It is an important mediator involved in many cytokine induced immune and inflammatory responses. This gene along with interleukin 1 receptor, type II (IL1R2), interleukin 1 receptor-like 2 (IL1RL2), and interleukin 1 receptor-like 1 (IL1RL1) form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000161344,antigen CD121a,interleukin 1 receptor alpha, type I,interleukin receptor 1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook