IL1B purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human IL1B protein.
Immunogen
IL1B (AAH08678.1, 1 a.a. ~ 269 a.a) full-length human protein.
Sequence
MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
IL1B MaxPab rabbit polyclonal antibody. Western Blot analysis of IL1B expression in mouse testis.Western Blot (Transfected lysate)
Western Blot analysis of IL1B expression in transfected 293T cell line (H00003553-T01) by IL1B MaxPab polyclonal antibody.
Lane 1: IL1B transfected lysate(30.70 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between IL1B and A2M. HeLa cells were stained with anti-IL1B rabbit purified polyclonal 1:1200 and anti-A2M mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — IL1B
Entrez GeneID
3553GeneBank Accession#
NM_000576Protein Accession#
AAH08678.1Gene Name
IL1B
Gene Alias
IL-1, IL1-BETA, IL1F2
Gene Description
interleukin 1, beta
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. [provided by RefSeq
Other Designations
catabolin|preinterleukin 1 beta|pro-interleukin-1-beta
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Ginger Phenylpropanoids Inhibit IL-1{beta} and Prostanoid Secretion and Disrupt Arachidonate-Phospholipid Remodeling by Targeting Phospholipases A2.
Nievergelt A, Marazzi J, Schoop R, Altmann KH, Gertsch J.
Journal of immunology 2011 Oct; 187(8):4140.
Application:WB-Ce, Human, Human monocytes.
-
Ginger Phenylpropanoids Inhibit IL-1{beta} and Prostanoid Secretion and Disrupt Arachidonate-Phospholipid Remodeling by Targeting Phospholipases A2.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com